Product Name: NPY (29-64)
Product Number: PE-01AAZ80
Size: 200 µg      Price:86.00
1 mg      $US173.00
5 mg      374.00
Peptide Name: NPY (29-64)

Product Use: Neurotransmitter peptide.

Peptide Production Method: Solid-phase peptide synthesis

Peptide Origin: Homo sapiens

Peptide Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

Peptide Modifications N Terminus: Free amino

Peptide Modifications C Terminus: Amide

Peptide Molecular Mass Calculated: 4271.6 Da

Peptide Purity Percent after Synthesis and Purification: >80

Peptide Appearance: White powder

Peptide Form: Solid

Storage Conditions: -20°C

Scientific Background: Pancreatic polypeptide-related peptide; Human cDNA encoding neuropeptide tyrosine.
References

[1] Pelz KM, Dark J. ICV NPY Y1 receptor agonist but not Y5 agonist induces torpor-like hypothermia in cold-acclimated Siberian hamsters. Am J Physiol Regul Integr Comp Physiol. 2007 Jun;292(6):R2299-311. Epub 2007 Mar 1. PMID: 17332160.

[2] Kapoor JR, Sladek CD. Substance P and NPY differentially potentiate ATP and adrenergic stimulated vasopressin and oxytocin release. Am J Physiol Regul Integr Comp Physiol. 2001 Jan;280(1):R69-78. PMID: 11124136.

[3] Minth CD, Bloom SR, Polak JM, Dixon JE. Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine.Proc Natl Acad Sci U S A. 1984 Jul;81(14):4577-81. PMID: 6589611.