Product Name: IAPP (23-52)
Product Number: PE-01AMB95
| Size: | 200 µg | Price: | 96.00 | |
| 1 mg | $US | 192.00 |
Peptide Name: IAPP (23-52)
Peptide Production Method: Solid-phase peptide synthesis
Peptide Origin: Homo sapiens
Peptide Sequence: TPIESHQVEKRKCNTATCATQRLANFLVHS
Peptide Modifications N Terminus: Free amino
Peptide Modifications C Terminus: Free carboxyl
Peptide Molecular Mass Calculated: 3383.7 Da
Peptide Purity Percent after Synthesis and Purification: >95
Peptide Appearance: White powder
Peptide Form: Solid
Storage Conditions: -20°C
Peptide Production Method: Solid-phase peptide synthesis
Peptide Origin: Homo sapiens
Peptide Sequence: TPIESHQVEKRKCNTATCATQRLANFLVHS
Peptide Modifications N Terminus: Free amino
Peptide Modifications C Terminus: Free carboxyl
Peptide Molecular Mass Calculated: 3383.7 Da
Peptide Purity Percent after Synthesis and Purification: >95
Peptide Appearance: White powder
Peptide Form: Solid
Storage Conditions: -20°C
Scientific Background: IAPP selectively inhibits insulin-stimulated glucose use and prevents glycogen from being deposited in the muscles, does not affect adopocyte glucuse utilization.
© Kinexus Bioinformatics Corporation 2017