Product Name: C34, gp41 HIV (1-34)
Product Number: PE-01ANL90
Size: 200 µg      Price:95.00
1 mg      $US190.00
Peptide Name: C34, gp41 HIV (1-34)

Peptide Production Method: Solid-phase peptide synthesis

Peptide Origin: Homo sapiens

Peptide Sequence: WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL

Peptide Modifications N Terminus: Free amino

Peptide Modifications C Terminus: Free carboxyl

Peptide Molecular Mass Calculated: 4248.7 Da

Peptide Purity Percent after Synthesis and Purification: >90

Peptide Appearance: White powder

Peptide Form: Solid

Storage Conditions: -20°C
References

[1] Zhao L, Tong P, Chen YX, Hu ZW, Wang K, Zhang YN, Zhao DS, Cai LF, Liu KL, Zhao YF, Li YM. (2012) A multi-functional peptide as an HIV-1 entry inhibitor based on self-concentration, recognition, and covalent attachment.Org Biomol Chem. 10(32):6512-20. doi: 10.1039/c2ob25853f.

[2] Paolo Ingallinella, Elisabetta Bianchi, Neal A. Ladwa, Ying-Jie Wang, Renee Hrin, Maria Veneziano, Fabio Bonelli, Thomas J. Ketas, John P. Moore, Michael D. Miller and Antonello Pessi (2009) Addition of a cholesterol group to an HIV-1 peptide fusion inhibitor dramatically increases its antiviral potency. PNAS 106(14): 5801–5806, doi: 10.1073/pnas.0901007106.

[3] de Rosny E, Vassell R, Jiang S, Kunert R, Weiss CD (2004) Binding of the 2F5 monoclonal antibody to native and fusion-intermediate forms of human immunodeficiency virus type 1 gp41: implications for fusion-inducing conformational changes. J. Virol. 78, 2627-31. PMID: 14963170