Product Name: C34, gp41 HIV (1-34)
Product Number: PE-01ANL90
| Size: | 200 µg | | Price: | 95.00 |
| 1 mg | | $US | 190.00 |
Peptide Name: C34, gp41 HIV (1-34)
Peptide Production Method: Solid-phase peptide synthesis
Peptide Origin: Homo sapiens
Peptide Sequence: WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
Peptide Modifications N Terminus: Free amino
Peptide Modifications C Terminus: Free carboxyl
Peptide Molecular Mass Calculated: 4248.7 Da
Peptide Purity Percent after Synthesis and Purification: >90
Peptide Appearance: White powder
Peptide Form: Solid
Storage Conditions: -20°C
References[1] Zhao L, Tong P, Chen YX, Hu ZW, Wang K, Zhang YN, Zhao DS, Cai LF, Liu KL, Zhao YF, Li YM. (2012) A multi-functional peptide as an HIV-1 entry inhibitor based on self-concentration, recognition, and covalent attachment.Org Biomol Chem. 10(32):6512-20. doi: 10.1039/c2ob25853f. [2] Paolo Ingallinella, Elisabetta Bianchi, Neal A. Ladwa, Ying-Jie Wang, Renee Hrin, Maria Veneziano, Fabio Bonelli, Thomas J. Ketas, John P. Moore, Michael D. Miller and Antonello Pessi (2009) Addition of a cholesterol group to an HIV-1 peptide fusion inhibitor dramatically increases its antiviral potency. PNAS 106(14): 5801–5806, doi: 10.1073/pnas.0901007106.