Product Name: CDC2-CT (CDK1-1)
Product Number: AB-NK025-4
| Size: |  25 µg |        | Price: | 89.00 | 
 |  |        | $US |  | 
Target Full Name: Cyclin-dependent protein-serine kinase 1; Cell division control protein 2 homologue
Target Alias: Cdc2; CDC28; CDC28A; CDC2A; Cell division control protein 2; Cell division cycle 2, G1 to S and G2 to M; Cyclin-dependent kinase 1; P34 protein kinase; Kinase Cdc2; MPF; DKFZp686L20222; MGC111195; ENSG00000170312
Product Type Specific: Protein kinase pan-specific antibody
Antibody Code: NK025-4
Antibody Target Type: Pan-specific
Protein UniProt: P06493 Protein SigNET: P06493 Antibody Type: Polyclonal
Antibody Host Species: Rabbit
 Antibody Immunogen Source: Human CDK1 (CDC2) sequence peptide
Antibody Immunogen Sequence: CFLSKMLVYDPAKRISGKMALKHPYFDDLDNQIKKM
Antibody Immunogen Description: Corresponds to amino acid residues F263 to M297; C-terminus
Production Method: The immunizing peptide was produced on an A.B.I. automated peptide synthesizer. The peptide was cleaved from the synthesis resin with HF and purified by reverse-phase hplc chromatography. Purity was assessed by analytical hplc and the amino acid sequence confirmed by amino acid analysis. This peptide was coupled to KLH prior to immunization into rabbits. New Zealand White rabbits were subcutaneously injected with KLH-coupled immunizing peptide every 4 weeks. The sera from these animals was applied onto an agarose column to which the immunogen peptide was thio-linked. Antibody was eluted from the column with 0.1 M glycine, pH 2.5. Subsequently, the antibody solution was neutralized to pH 7.0 with saturated Tris.
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
  
Storage Buffer: 100 mM Tris-glycine, pH 7.0
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months, but either 0.1% sodium azide or 0.05% Thimerasol should be added. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Antibody microarray 
Antibody Dilution Recommended: 2 µg/ml for immunoblotting
Antibody Species Reactivity: Human; Mouse; Rat; Sheep
Antibody Positive Control: The observed molecular mass of the processed target protein on SDS-PAGE gels is reported to be around 30-35 kDa.
Antibody Cross Reactivity: In rat tissues it cross reacts with 46 and 70 kDa proteins.
Scientific Background: CDK1 (CDC2) is a protein-serine/threonine kinase of the CMGC group and CDK family. It plays an essential role in cell cycle control in eukaryotic cells by regulating the centrosome cycle, mitotic onset, G2-M phase transition, G1 progression, and G1-S phase transition through an association with various interphase cyclin proteins. Phosphorylation events at T14 or Y15 on the protein are inactivating, while phosphorylation at T161 is stimulatory. CDK1 appears to be a tumour requiring protein (TRP). Gain-of-function mutations in the CDK1 gene have been linked to several forms of cancer, indicating an oncogenic role for the CDK1 protein. Cells transformed with the oncogene MYC undergo apoptosis when treated with small-molecule CDK1 inhibitors. Elevated expression of CDK1 has been reported as a diagnostic marker for cancer progression in esophageal adenocarcinoma, potentially reflecting the role of the CDK1 protein in tumourigenesis. CDK1 expression can be used as a prognostic indicator for early breast cancer. For example, breast cancer tumours with high expression of CDK1 are correlated with a significantly lower 5-year patient survival rate (66. 9%) than tumours that have low levels of CDK1 expression (84. 2%). 
  
